PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10009431m
Common NameEUTSA_v10009431mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 192aa    MW: 21201.1 Da    PI: 9.1793
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10009431mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.63.9e-141864450
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     e +  r vtfskRrngi  K  EL vLC+ae   +++s  gk y++ 
  Thhalv10009431m 18 EKNGDRMVTFSKRRNGIYTKLAELTVLCGAETGFLVYSGAGKPYTFG 64
                     566679***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-19766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.679767IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-22881IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-16929IPR002100Transcription factor, MADS-box
PfamPF003192.8E-171663IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-162944IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-164465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MREKKTKGKQ KIKIRKVEKN GDRMVTFSKR RNGIYTKLAE LTVLCGAETG FLVYSGAGKP  60
YTFGSPSFIA VAERFLEINR RVVINGESSS SSAIVDAHKK VKVEELCKTF NNLMEEAEAE  120
AERGKAVAAA KALGTSTLPV ESDDDAWWKS DPDDKEEATR VLASFEEFYE KLCEVAVRRR  180
RSFGCNGAST S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415528.11e-138hypothetical protein EUTSA_v10009431mg
TrEMBLV4MQB51e-138V4MQB5_EUTSA; Uncharacterized protein
STRINGAT1G29962.17e-58(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46761352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.12e-38AGAMOUS-like 64